- Search results for GeneID 397225
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
15 products were found matching "GeneID 397225"!
Close filters
Filter by:
No results were found for the filter!
NEW
Item number: CR-C03004-100UG
Sequence: MHKCDITLQE IIKTLNILTA RKNSCMELPV TDVFAAPENT TEKETFCRAS TVLRHIYRHH TCMKSLLSGL DRNLSSMANM TCSVHEAKKS FLERLKTIMK with polyhistidine tag at the C-terminus Endotoxin level: <0.1 EU per 1 µg of the protein by the LAL method. Protein function: Participates in at least several B-cell activation processes as well...
Keywords: | IL4, IL-4, BSF-1, Interleukin-4, B-cell stimulatory factor 1, Lymphocyte stimulatory factor 1 |
Application: | Cell culture |
Expressed in: | E.coli |
Origin: | swine |
From 120.00€
*
Item number: ELK-ELK5717.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Pig IL4. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Pig IL4. Next, Avidin...
Keywords: | IL4, IL-4, BSF-1, Interleukin-4, B-cell stimulatory factor 1, Lymphocyte stimulatory factor 1 |
Application: | ELISA |
Species reactivity: | swine |
From 470.00€
*
Item number: ARG81290.96
Protein function: Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the...
Keywords: | IL4, IL-4, BSF-1, Interleukin-4, B-cell stimulatory factor 1, Lymphocyte stimulatory factor 1 |
Application: | ELISA |
Species reactivity: | swine |
824.00€
*
Item number: BR-A05419.96
Enzyme ImmunoAssay (EIA) is a technique to detect and quantify antigens (proteins, hormones.) or antibodies in samples. It relies on the ability of an antibody to bind a specific antigen. Either the antibody or the antigen is labelled with an enzyme whose substrate is a chromogen or a fluorogen converted in a...
Keywords: | C-X-C motif chemokine |
553.00€
*
Item number: G-PRFI00098.96
Application: | ELISA |
Species reactivity: | swine |
641.00€
*
Item number: DIY0726S-003
The swine IL-4 Do-It-Yourself ELISA contains capture antibody, standard, and detection antibody for development of a swine IL-4 ELISA. The antibodies have been determined to function in an ELISA with the standard provided. Optimal buffers, concentrations, incubation times, incubation temperatures, and methods for...
Keywords: | IL-4, B-cell stimulatory factor 1, BSF-1, Lympphocyte stimulatory factor 1 |
Application: | ELISA |
Species reactivity: | swine |
From 1,056.00€
*
Item number: PB0475S-100
Protein function: Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the...
Keywords: | Anti-IL4, Anti-IL-4, Anti-BSF-1, Anti-Interleukin-4, Anti-B-cell stimulatory factor 1, Anti-Lymphocyte stimulatory factor 1 |
Application: | ELISA |
Host: | Goat |
Species reactivity: | swine, bovine, dolphin, feline |
521.00€
*
Item number: ARG70204.100
Protein function: Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the...
Keywords: | IL4, IL-4, BSF-1, Interleukin-4, B-cell stimulatory factor 1, Lymphocyte stimulatory factor 1 |
Application: | SDS-PAGE, Cell culture |
Origin: | swine |
From 336.00€
*
Item number: E-EL-P3006.24
Colormetric. Detection Range: 1.56-100 pg/mL. Sensitivity: 0.89 pg/mL. Recovery rate: 80%-120%. Precision: Both intra-CV and inter-CV are < 10%.
Keywords: | IL4, IL-4, BSF-1, Interleukin-4, B-cell stimulatory factor 1, Lymphocyte stimulatory factor 1 |
Application: | ELISA |
Species reactivity: | swine |
From 119.00€
*
Item number: E-PKSS000004.5
Activity: Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is <0.6 ng/mL. Sequence: MGLTSQLIPTLVCLLACTSNFVHGHKCDITLQEIIKTLNILTARKNSCMELPVTDVFAAPENTTEKETFCRASTVLRHIYRHHTCMKSLLSGLDRNLSSMANMTCSVHEAKKSTLKDFLERLKTIMKEKYSKC. Fusion tag: N-His Endotoxin: Please contact us for more...
Keywords: | IL4, IL-4, BSF-1, Interleukin-4, B-cell stimulatory factor 1, Lymphocyte stimulatory factor 1, Recombinant Swine IL-4... |
Application: | Active, cell culture |
Expressed in: | E.coli |
Origin: | swine |
MW: | 15.85 kD |
234.00€
*
Item number: PBB0484S-050
Protein function: Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the...
Keywords: | Anti-IL4, Anti-IL-4, Anti-BSF-1, Anti-Interleukin-4, Anti-B-cell stimulatory factor 1, Anti-Lymphocyte stimulatory factor 1 |
Application: | ELISA |
Host: | Goat |
Species reactivity: | swine, bovine, dolphin, feline |
535.00€
*
Item number: RP0300S-005
Produced in Yeast. Amino acid sequence: HKCDITLQEI IKTLNILTAR KNSCMELPVT DVFAAPENTT EKETFCRAST VLRHIYRHHT CMKSLLSGLD RNLSSMANMT CSVHEAKKST LKDFLERLKT IMKEKYSKC (109).
Keywords: | IL-4, B-cell stimulatory factor 1, BSF-1, Lympphocyte stimulatory factor 1 |
Application: | Bioassays |
Expressed in: | Yeast |
Origin: | swine |
MW: | 12,5 kD |
From 206.00€
*