15 products were found matching "GeneID 397225"!

Sequence: MHKCDITLQE IIKTLNILTA RKNSCMELPV TDVFAAPENT TEKETFCRAS TVLRHIYRHH TCMKSLLSGL DRNLSSMANM TCSVHEAKKS FLERLKTIMK with polyhistidine tag at the C-terminus Endotoxin level: <0.1 EU per 1 µg of the protein by the LAL method. Protein function: Participates in at least several B-cell activation processes as well...

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Pig IL4. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Pig IL4. Next, Avidin...

Protein function: Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the...

Enzyme ImmunoAssay (EIA) is a technique to detect and quantify antigens (proteins, hormones.) or antibodies in samples. It relies on the ability of an antibody to bind a specific antigen. Either the antibody or the antigen is labelled with an enzyme whose substrate is a chromogen or a fluorogen converted in a...

The swine IL-4 Do-It-Yourself ELISA contains capture antibody, standard, and detection antibody for development of a swine IL-4 ELISA. The antibodies have been determined to function in an ELISA with the standard provided. Optimal buffers, concentrations, incubation times, incubation temperatures, and methods for...

Protein function: Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the...

Protein function: Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the...

Colormetric. Detection Range: 1.56-100 pg/mL. Sensitivity: 0.89 pg/mL. Recovery rate: 80%-120%. Precision: Both intra-CV and inter-CV are < 10%.

Activity: Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is <0.6 ng/mL. Sequence: MGLTSQLIPTLVCLLACTSNFVHGHKCDITLQEIIKTLNILTARKNSCMELPVTDVFAAPENTTEKETFCRASTVLRHIYRHHTCMKSLLSGLDRNLSSMANMTCSVHEAKKSTLKDFLERLKTIMKEKYSKC. Fusion tag: N-His Endotoxin: Please contact us for more...

Protein function: Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the...

Produced in Yeast. Amino acid sequence: HKCDITLQEI IKTLNILTAR KNSCMELPVT DVFAAPENTT EKETFCRAST VLRHIYRHHT CMKSLLSGLD RNLSSMANMT CSVHEAKKST LKDFLERLKT IMKEKYSKC (109).